| Desktop | 80/100 | ✔ |
| Mobile | 42/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 32 KB | ✔ |
| Compression | NO | ✘ |
| Text/Html Ratio | 7325 / 32617 (bytes) = 22.46% | ✔ |
| Load Time | 0.72 second | ✔ |
| Mobile Ready | 97/100 | ✔ |
| In-Page Links | 26 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 3 / 5 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| maker | 18 | ✘ | ✘ | ✔ |
| vacuum | 15 | ✘ | ✘ | ✔ |
| hair | 11 | ✘ | ✘ | ✔ |
| bissell | 11 | ✘ | ✘ | ✔ |
| ikich | 10 | ✘ | ✘ | ✔ |
| machine | 9 | ✘ | ✘ | ✔ |
| portable | 7 | ✘ | ✘ | ✔ |
| april | 7 | ✘ | ✘ | ✔ |
| cubes | 7 | ✘ | ✘ | ✘ |
| counter | 7 | ✘ | ✘ | ✔ |
| have | 6 | ✘ | ✘ | ✘ |
| amazon | 6 | ✘ | ✘ | ✘ |
| there | 5 | ✘ | ✘ | ✘ |
| rewind | 5 | ✘ | ✘ | ✔ |
| upright | 5 | ✘ | ✘ | ✔ |
|
With 0.72 seconds in page load, 32 KB of page size and all other reports below, the healthylivingkitchenappliances.com has a SEO score of 57 out of 100 |
| Title | Healthy Living Kitchen Appliances - Connecting You with the Healthy Products and Services |
| Description | Connecting You with the Healthy Products and Services |
| Keyword |
| Age | 0 Years, 4 Days |
| Created | 13th-Apr-2020 |
| Updated | 13th-Apr-2020 |
| Expiry | 13th-Apr-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain name: healthylivingkitchenappliances.com Registry Domain ID: 2514526237_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 0001-01-01T00:00:00.00Z Creation Date: 2020-04-13T20:06:07.00Z Registrar Registration Expiration Date: 2021-04-13T20:06:07.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.6613102107 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: WhoisGuard Protected Registrant Organization: WhoisGuard, Inc. Registrant Street: P.O. Box 0823-03411 Registrant City: Panama Registrant State/Province: Panama Registrant Postal Code: Registrant Country: PA Registrant Phone: +507.8365503 Registrant Phone Ext: Registrant Fax: +51.17057182 Registrant Fax Ext: Registrant Email: 0d80665818844868873549285319caf4.protect@whoisguard.com Registry Admin ID: Admin Name: WhoisGuard Protected Admin Organization: WhoisGuard, Inc. Admin Street: P.O. Box 0823-03411 Admin City: Panama Admin State/Province: Panama Admin Postal Code: Admin Country: PA Admin Phone: +507.8365503 Admin Phone Ext: Admin Fax: +51.17057182 Admin Fax Ext: Admin Email: 0d80665818844868873549285319caf4.protect@whoisguard.com Registry Tech ID: Tech Name: WhoisGuard Protected Tech Organization: WhoisGuard, Inc. Tech Street: P.O. Box 0823-03411 Tech City: Panama Tech State/Province: Panama Tech Postal Code: Tech Country: PA Tech Phone: +507.8365503 Tech Phone Ext: Tech Fax: +51.17057182 Tech Fax Ext: Tech Email: 0d80665818844868873549285319caf4.protect@whoisguard.com Name Server: ns6467.hostgator.com Name Server: ns6468.hostgator.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-04-16T11:18:14.12Z |
| Server IP | 192.254.234.103 |
| Server Location | United States |
| Service Provider | Unified Layer |
| Domains (TLD) | Status |
|---|---|
| healthylivingkitchenappliances.net | Available |
| healthylivingkitchenappliances.org | Available |
| healthylivingkitchenappliances.biz | Already Registered |
| healthylivingkitchenappliances.io | Already Registered |
| healthylivingkitchenappliances.info | Available |
| Domains (TLD) | Status |
|---|---|
| healthylivingkitchenapliances.com | Available |
| bealthylivingkitchenappliances.com | Available |
| gealthylivingkitchenappliances.com | Available |
| tealthylivingkitchenappliances.com | Available |
| yealthylivingkitchenappliances.com | Available |
| Novahpurifier.com |
| Be-fithomes.com |
| Iptvoficialjeantutoriais.com |
| Thebibliophilia.com |
| Runescape-secured.com |
| Crewsignis.com |
| Notyouraveragesocialworker.com |
| Brickstonemason.com |
| Diangying.com |
| Himedik.com |